PEDF (SERPINF1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SERPINF1 antibody: synthetic peptide directed towards the N terminal of human SERPINF1. Synthetic peptide located within the following region: GALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	serpin family F member 1
Database Link	NP_002606 Entrez Gene 5176 Human UniProt ID P36955
Background	The SERPINF1 gene may play a significant role in determining the balance of angiogenesis/ antiangiogenesis during atherogenesis. A novel role of extracellular phosphorylation is shown to completely change the nature of this gene from a neutrophic to an antiangiogenic factor.
Synonyms	EPC-1; OI6; OI12; PEDF; PIG35
Note	Immunogen sequence homology: Human: 100%; Mouse: 86%; Sheep: 86%; Guinea pig: 80%; Horse: 80%; Pig: 80%; Dog: 78%; Rat: 75%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.