ETS1 Rabbit Polyclonal Antibody
CNY 4,381.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 3,080.00
CNY 9,998.00
CNY 4,840.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 50 kDa |
Gene Name | ETS proto-oncogene 1, transcription factor |
Database Link | |
Background | ETS-1 is a member of the ets family of transcription factors, which are key mediators of physiological and pathological processes. |
Synonyms | ETS-1; EWSR2; p54 |
Note | Immunogen sequence homology: Bovine: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 84%; African clawed frog: 76% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |