Mineralocorticoid Receptor (NR3C2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NR3C2 antibody: synthetic peptide directed towards the C terminal of human NR3C2. Synthetic peptide located within the following region: VSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	94 kDa
Gene Name	nuclear receptor subfamily 3 group C member 2
Database Link	NP_001159576 Entrez Gene 4306 Human UniProt ID P08235
Background	NR3C2 is a receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. It binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels.
Synonyms	MCR; MLR; MR; NR3C2VIT
Note	Immunogen sequence homology: Chicken: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; African clawed frog: 92%; Bovine: 92%
Reference Data
Protein Families	Druggable Genome, Nuclear Hormone Receptor, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.