B MyB (MYBL2) Rabbit Polyclonal Antibody

CAT#: TA330054

Rabbit Polyclonal Anti-MYBL2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of v-myb myeloblastosis viral oncogene homolog (avian)-like 2 (MYBL2)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human v-myb myeloblastosis viral oncogene homolog (avian)-like 2 (MYBL2), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human v-myb myeloblastosis viral oncogene homolog (avian)-like 2 (MYBL2), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MYBL2 antibody: synthetic peptide directed towards the N terminal of human MYBL2. Synthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 79 kDa
Gene Name MYB proto-oncogene like 2
Background Myb-Related Protein B (MYBL2), a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined.
Synonyms B-MYB; BMYB
Note Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 92%; Guinea pig: 85%; Zebrafish: 83%; Rat: 78%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...