Rel B (RELB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RELB antibody: synthetic peptide directed towards the middle region of human RELB. Synthetic peptide located within the following region: FTYLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRKKKPAILDH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	62 kDa
Gene Name	RELB proto-oncogene, NF-kB subunit
Database Link	NP_006500 Entrez Gene 5971 Human UniProt ID Q01201
Background	RELB neither associates with DNA nor with RELA/p65 or REL. It stimulates promoter activity in the presence of NFKB2/p49.
Synonyms	I-REL; IREL; REL-B
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%; Dog: 85%; Horse: 85%; Mouse: 85%; Bovine: 78%
Reference Data
Protein Families	Druggable Genome, Transcription Factors
Protein Pathways	MAPK signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.