SNAP45 (SNAPC2) Rabbit Polyclonal Antibody
CAT#: TA330156
Rabbit Polyclonal Anti-SNAPC2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SNAPC2 antibody: synthetic peptide directed towards the middle region of human SNAPC2. Synthetic peptide located within the following region: STEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSLPEELPL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 35 kDa |
Gene Name | small nuclear RNA activating complex polypeptide 2 |
Database Link | |
Background | SNAPC2 is a component of the snRNA activating protein complex (SNAPc). SNAPC2 is exceptionally proline-rich, interacts strongly with TBP, and, other SNAPC components, is required for both RNA polymerase II and III transcription of snRNA genes. |
Synonyms | PTFDELTA; SNAP45 |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |