Estrogen Related Receptor beta (ESRRB) Rabbit Polyclonal Antibody
CAT#: TA330220
Rabbit Polyclonal Anti-ESRRB Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ESRRB antibody: synthetic peptide directed towards the N terminal of human ESRRB. Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | estrogen related receptor beta |
Database Link | |
Background | ESRRB encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. Sequence Note: The sequence AF094517.1 is from a chimeric clone. Only the ESRRB sequence was propagated into this RefSeq record. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | DFNB35; ERR2; ERRb; ESRL2; NR3B2 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93% |
Reference Data | |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Estrogen Related Receptor beta产品