PCTAIRE3 (CDK18) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PCTK3 antibody: synthetic peptide directed towards the N terminal of human PCTK3. Synthetic peptide located within the following region: IMNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	cyclin-dependent kinase 18
Database Link	NP_997668 Entrez Gene 5129 Human UniProt ID Q07002
Background	PCTK3 belongs to the protein kinase superfamily, CMGC Ser/Thr protein kinase family, CDC2/CDKX subfamily. PCTK3 contains 1 protein kinase domain. It may play a role in signal transduction cascades in terminally differentiated cells.
Synonyms	PCTAIRE; PCTAIRE3; PCTK3
Note	Immunogen sequence homology: Bovine:100%; Chicken:100%; Green puffer:100%; Sumatran orangutan:100%; Human:100%; Rat:92%; Mouse:92%; Western clawed frog:91%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.