CMKLR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CMKLR1 antibody: synthetic peptide directed towards the C terminal of human CMKLR1. Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	chemerin chemokine-like receptor 1
Database Link	NP_004063 Entrez Gene 1240 Human UniProt ID Q99788
Background	CMKLR1 mediates the Resolvin E1 signal to attenuate nuclear factor-kappaB.
Synonyms	CHEMERINR; ChemR23; DEZ; RVER1
Note	Immunogen sequence homology: Human: 100%; Mouse: 93%; Rat: 93%
Reference Data
Protein Families	Druggable Genome, GPCR, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.