Hsp47 (SERPINH1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IP, WB
Recommend Dilution	WB, IP
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SERPINH1 antibody: synthetic peptide directed towards the C terminal of human SERPINH1. Synthetic peptide located within the following region: DIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRLKGDKMRDEL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	46 kDa
Gene Name	serpin family H member 1
Database Link	NP_001226 Entrez Gene 12406 MouseEntrez Gene 871 Human UniProt ID P50454
Background	Serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1)
Synonyms	AsTP3; CBP1; CBP2; gp46; HSP47; OI10; PIG14; PPROM; RA-A47; SERPINH2
Note	Immunogen sequence homology: Dog: 91%; Horse: 91%; Human: 91%; Mouse: 91%; Pig: 91%; Rat: 91%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.