CIDE B (CIDEB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CIDEB antibody: synthetic peptide directed towards the middle region of human CIDEB. Synthetic peptide located within the following region: LGPKKVLRELLRWTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	cell death-inducing DFFA-like effector b
Database Link	NP_055245 Entrez Gene 27141 Human UniProt ID Q9UHD4
Background	CIDEB activates apoptosis.
Synonyms	cell death-inducing DFFA-like effector b
Note	Immunogen sequence homology: Human: 100%; Pig: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.