DP1 (TFDP1) Rabbit Polyclonal Antibody
CAT#: TA330410
Rabbit Polyclonal Anti-TFDP1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TFDP1 antibody: synthetic peptide directed towards the middle region of human TFDP1. Synthetic peptide located within the following region: SASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDED |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 45 kDa |
Gene Name | transcription factor Dp-1 |
Database Link | |
Background | The E2F transcription factor family regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors and may have a role in progression of some hepatocellular carcinomas by promoting growth of the tumor cells. The E2F transcription factor family (see MIM 189971) regulates the expression of various cellular promoters, particularly those involved in the cell cycle. E2F factors bind to DNA as homodimers or heterodimers in association with dimerization partner DP1. TFDP1 may be the first example of a family of related transcription factors; see TFDP2 (MIM 602160). [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | DILC; Dp-1; DP1; DRTF1 |
Note | Immunogen sequence homology: Chicken: 100%; Human: 100%; Mouse: 100%; African clawed frog: 92%; Bovine: 92%; Zebrafish: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Cell cycle, TGF-beta signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |