HBP1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HBP1 antibody: synthetic peptide directed towards the middle region of human HBP1. Synthetic peptide located within the following region: FSKNCGSPGSSQLSSNSLYAKAVKNHSSGTVSATSPNKCKRPMNAFMLFA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	HMG-box transcription factor 1
Database Link	NP_036389 Entrez Gene 26959 Human UniProt ID O60381
Background	HBP1 is a transcriptional repressor that binds to the promoter region of target genes. It plays a role in the regulation of the cell cycle and of the Wnt pathway. HBP1 binds preferentially to the sequence 5'-TTCATTCATTCA-3'.The protein also disrupts the interaction between DNA and TCF4.
Synonyms	FLJ16340
Note	Dog: 100%; Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.