SND1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SND1 antibody: synthetic peptide directed towards the N terminal of human SND1. Synthetic peptide located within the following region: LPDYYLVTVMLSGIKCPTFRREADGSETPEPFAAEAKFFTESRLLQRDVQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	100 kDa
Gene Name	staphylococcal nuclease and tudor domain containing 1
Database Link	NP_055205 Entrez Gene 27044 Human UniProt ID Q7KZF4
Background	SND1 was originally characterized as a transcriptional coactivator for Epstein-Barr virus nuclear antigen 2. It is a STAT6 TAD interacting protein containing staphylococcal nuclease (SN)-like domain and tudor domain. p100 . The interaction is mediated by the TAD domain of STAT6 and the SN-like domain of SND1. SND1 associates with the large subunit of RNA polymerase II and is mediating interaction between STAT6 and RNA polymerase II. It was identified as a novel coactivator for STAT6 and suggest its functions as a bridging factor between STAT6 and the basal transcription machinery
Synonyms	p100; TDRD11
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.