Mohawk homeobox (MKX) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MKX antibody: synthetic peptide directed towards the middle region of human MKX. Synthetic peptide located within the following region: IKSENSVIKAGVRPESRASEDYVAPPKYKSSLLNRYLNDSLRHVMATNTT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	mohawk homeobox
Database Link	NP_775847 Entrez Gene 283078 Human UniProt ID Q8IYA7
Background	MKX contains 1 homeobox DNA-binding domain and belongs to the TALE/IRO homeobox family. It may act as a morphogenetic regulator of cell adhesion.
Synonyms	C10orf48; IFRX; IRXL1
Note	Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 92%; Mouse: 92%; Zebrafish: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.