CCDC198 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C14orf105 antibody is: synthetic peptide directed towards the C-terminal region of Human C14orf105. Synthetic peptide located within the following region: WKIGKMETWLHEQEAQGQLLWDSSSSDSDEQGKDEKKPRALVRTRTERIP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	chromosome 14 open reading frame 105
Database Link	NP_060638 Entrez Gene 55195 Human UniProt ID Q9NVL8
Background	The function of this protein remains unknown.
Synonyms	FLJ10650
Note	Human: 100%; Horse: 86%; Yeast: 83%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.