C10orf84 (FAM204A) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FAM204A antibody is: synthetic peptide directed towards the N-terminal region of Human FAM204A. Synthetic peptide located within the following region: NSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPIDM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	family with sequence similarity 204 member A
Database Link	NP_071346 Entrez Gene 63877 Human UniProt ID Q9H8W3
Background	The function of this protein remains unknown.
Synonyms	bA319I23.1; C10orf84
Note	Human: 100%; Dog: 79%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.