CLNMT (CAMKMT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CAMKMT antibody is: synthetic peptide directed towards the C-terminal region of Human CAMKMT. Synthetic peptide located within the following region: QFCNLAEKAGFCIQRHENYDEHISNFHSKLKKENPDIYEENLHYPLLLIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	calmodulin-lysine N-methyltransferase
Database Link	NP_079042 Entrez Gene 79823 Human UniProt ID Q7Z624
Background	This gene encodes a class I protein methyltransferase that acts in the formation of trimethyllysine in calmodulin. The protein contains a AdoMet-binding motif and may play a role in calcium-dependent signaling.
Synonyms	C2orf34; Cam; CaM KMT; CLNMT; KMT
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.