TTC30A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TTC30A antibody is: synthetic peptide directed towards the C-terminal region of Human TTC30A. Synthetic peptide located within the following region: IEKEEEQLSYDDPNRKMYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	76 kDa
Gene Name	tetratricopeptide repeat domain 30A
Database Link	NP_689488 Entrez Gene 92104 Human UniProt ID Q86WT1
Background	TTC30A is required for polyglutamylation of axonemal tubulin. It plays a role in anterograde intraflagellar transport (IFT), the process by which cilia precursors are transported from the base of the cilium to the site of their incorporation at the tip.
Synonyms	IFT70A
Note	Human: 100%; Dog: 79%; Rat: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.