Semaphorin 3B (SEMA3B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SEMA3B antibody is: synthetic peptide directed towards the middle region of Human SEMA3B. Synthetic peptide located within the following region: FRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFRETA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	82 kDa
Gene Name	semaphorin 3B
Database Link	NP_004627 Entrez Gene 7869 Human UniProt ID Q13214
Background	SEMA3B inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
Synonyms	LUCA-1; SemA; SEMA5; SEMAA; semaV
Note	Human: 100%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Guinea pig: 79%
Reference Data
Protein Families	Secreted Protein, Transmembrane
Protein Pathways	Axon guidance

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.