NEU2 Rabbit Polyclonal Antibody
CNY 5,250.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 41 kDa |
Gene Name | neuraminidase 2 (cytosolic sialidase) |
Database Link | |
Background | This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. |
Synonyms | SIAL2 |
Note | Human: 100%; Pig: 79%; Dog: 77% |
Reference Data | |
Protein Pathways | Other glycan degradation, Sphingolipid metabolism |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3−/−) mice
,null,
American Journal of Physiology - Lung Cellular and Molecular Physiology
,PubMed ID 31617733
[NEU2]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |