Ribonuclease Inhibitor (RNH1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RNH1 antibody is: synthetic peptide directed towards the N-terminal region of Human RNH1. Synthetic peptide located within the following region: YCSLSAASCEPLASVLRAKPDFKELTVSNNDINEAGVRVLCQGLKDSPCQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Gene Name	ribonuclease/angiogenin inhibitor 1
Database Link	NP_002930 Entrez Gene 6050 Human UniProt ID P13489
Background	RNH1 is the inhibitor of pancreatic RNase and angiogenin. RNH1 may also function in the modulation of cellular activities.
Synonyms	RAI; RNH
Note	Rat: 100%; Human: 100%; Horse: 93%; Mouse: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.