LTC4S Rabbit Polyclonal Antibody
CAT#: TA330968
Rabbit polyclonal Anti-LTC4S Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LTC4S antibody: synthetic peptide directed towards the N terminal of human LTC4S. Synthetic peptide located within the following region: MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 16 kDa |
Gene Name | leukotriene C4 synthase |
Database Link | |
Background | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. |
Synonyms | MGC33147 |
Note | Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Zebrafish: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Modulation of leukotriene signaling inhibiting cell growth in chronic myeloid leukemia.
,null,
Leukemia & lymphoma
,PubMed ID 27931141
[LTC4S]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |