METTL7B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-METTL7B antibody: synthetic peptide directed towards the middle region of human METTL7B. Synthetic peptide located within the following region: FVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	22 kDa
Gene Name	methyltransferase like 7B
Database Link	NP_689850 Entrez Gene 196410 Human UniProt ID Q6UX53
Background	METTL7B belongs to the methyltransferase superfamily. It is a probable methyltransferase.
Synonyms	ALDI
Note	Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Horse: 92%; Rabbit: 86%; Pig: 85%; Guinea pig: 85%; Bovine: 79%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.