DLL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	72 kDa
Gene Name	delta like canonical Notch ligand 4
Database Link	NP_061947 Entrez Gene 54567 Human UniProt ID Q9NR61
Background	Notch ligands family members are characterized by a DSL domain, EGF repeats, and a transmembrane domain. DLL4 plays a role in the Notch signaling pathway. IT activates Notch-1 and Notch-4.
Synonyms	hdelta2
Note	Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 86%; Rat: 79%
Reference Data
Protein Families	Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Stem cell relevant signaling - DSL/Notch pathway, Transmembrane
Protein Pathways	Notch signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.