Smad6 Rabbit Polyclonal Antibody

CAT#: TA331110

Rabbit Polyclonal Anti-Smad6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (2)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Purified recombinant protein of Mouse SMAD family member 6 (Smad6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
    • 20 ug

CNY 2,900.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Smad6 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Smad6. Synthetic peptide located within the following region: PDGVWAYNRGEHPIFVNSPTLDAPGGRALVVRKVPPGYSIKVFDFERSGL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 54 kDa
Gene Name SMAD family member 6
Background Smad6 binds to regulatory elements in target promoter regions. It may block the BMP-SMAD1 signaling pathway by competing with SMAD4 for receptor-activated SMAD1-binding. It acts as a mediator of TGF-beta and BMP antiflammatory activity. It suppresses IL1R-TLR signaling through its direct interaction with PEL1, preventing NF-kappa-B activation, nuclear transport and NF-kappa-B-mediated expression of proinflammatory genes.
Synonyms hSMAD6; HsT17432; MADH6; MADH7
Note Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...