SCD1 (SCD) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SCD antibody: synthetic peptide directed towards the middle region of human SCD. Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	stearoyl-CoA desaturase
Database Link	NP_005054 Entrez Gene 6319 Human UniProt ID O00767
Background	Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.
Synonyms	FADS5; hSCD1; MSTP008; SCD1; SCDOS
Note	Human: 100%; Bovine: 92%; Dog: 85%; Pig: 85%; Goat: 85%; Sheep: 85%; Guinea pig: 85%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Biosynthesis of unsaturated fatty acids, PPAR signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.