ALF (GTF2A1L) Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 50 kDa |
Gene Name | general transcription factor IIA subunit 1 like |
Database Link | |
Background | The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involves the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. ALF is a germ cell-specific counterpart of the large (alpha/beta) subunit of general transcription factor TFIIA that is able to stabilize the binding of TBP to DNA and may be uniquely important to testis biology. |
Synonyms | ALF |
Note | Rat: 100%; Horse: 100%; Human: 100%; Dog: 92%; Bovine: 92%; Rabbit: 91%; Pig: 83%; Guinea pig: 83% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |