CAPN8 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CAPN8 antibody is: synthetic peptide directed towards the middle region of Human CAPN8. Synthetic peptide located within the following region: KLIRLRNPWGEVEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	calpain 8
Database Link	NP_001137434 Entrez Gene 388743 Human UniProt ID A6NHC0
Background	CAPN8 is a calcium-regulated non-lysosomal thiol-protease. CAPN8 is involved in membrane trafficking in the gastric surface mucus cells (pit cells) and may involve the membrane trafficking of mucus cells via interactions with coat protein. CAPN8 proteolytically cleaves the beta-subunit of coatomer complex.
Synonyms	nCL-2
Note	Human: 100%; Rat: 93%; Rabbit: 93%; Pig: 79%; Horse: 79%; Guinea pig: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.