ITPRID2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SSFA2 antibody is: synthetic peptide directed towards the C-terminal region of Human SSFA2. Synthetic peptide located within the following region: VDAAEGAPEVVGPKSEVEEGHGKLPSMPAAEEMHKNVEQDELQQVIREIK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	84 kDa
Gene Name	sperm specific antigen 2
Database Link	NP_006742 Entrez Gene 6744 Human UniProt ID P28290
Background	The function of this protein remains unknown.
Synonyms	CS-1; CS1; KRAP; SPAG13
Note	Human: 100%; Dog: 92%; Horse: 91%; Pig: 85%; Bovine: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.