TBC1D3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-TBC1D3 antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D3. Synthetic peptide located within the following region: NRFVDTWARDEDTVLKHLRASMKKLTRKQGDLPPPAKPEQGSSASRPVPA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	TBC1 domain family member 3
Database Link	NP_001116863 Entrez Gene 729873 Human UniProt ID Q8IZP1
Background	TBC1D3 acts as a GTPase activating protein for RAB5. TBC1D3 does not act on RAB4 or RAB11.
Synonyms	PRC17; TBC1D3A; TBC1D3F
Note	Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.