HABP4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-HABP4 antibody is: synthetic peptide directed towards the N-terminal region of Human HABP4. Synthetic peptide located within the following region: KERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLER
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	hyaluronan binding protein 4
Database Link	NP_055097 Entrez Gene 22927 Human UniProt ID Q5JVS0
Background	HABP4 may be involved in nuclear functions such as the remodeling of chromatin and the regulation of transcription.
Synonyms	57; IHABP-4; IHABP4; Ki-1; SERBP1L
Note	Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 92%; Rabbit: 92%; Pig: 85%; Guinea pig: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.