RABGAP1L Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RABGAP1L antibody is: synthetic peptide directed towards the middle region of Human RABGAP1L. Synthetic peptide located within the following region: EVVSLQRESDKEEPVTPTSGGGPMSPQDDEAEEESDNELSSGTGDVSKDC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	RAB GTPase activating protein 1-like
Database Link	NP_055672 Entrez Gene 9910 Human UniProt ID B7ZAP0
Background	The function of this protein remains unknown.
Synonyms	HHL; TBC1D18
Note	Rat: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.