Foxe1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Foxe1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FYGRTSPGQFGAALGPCYNPGGQLGAGGGGAYHSRHATAYPGAVDRFVSA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	forkhead box E1
Database Link	NP_899121 Entrez Gene 110805 Mouse UniProt ID Q8R2I0
Background	Foxe1 is a probable transcription factor. Foxe1 could be involved in thyroid gland organogenesis.
Synonyms	FKHL15; FOXE2; HFKH4; HFKL5; TITF2; TTF-2; TTF2
Note	Rat: 100%; Mouse: 100%; Bovine: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.