G3BP (G3BP1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IP, WB
Recommend Dilution	WB, IP
Reactivity	Rat, Mouse, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-G3BP1 antibody: synthetic peptide directed towards the N terminal of human G3BP1. Synthetic peptide located within the following region: RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	G3BP stress granule assembly factor 1
Database Link	NP_005745 Entrez Gene 27041 MouseEntrez Gene 171092 RatEntrez Gene 10146 Human UniProt ID Q13283
Background	This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding
Synonyms	G3BP; HDH-VIII
Note	Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.