GFRAL Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-GFRAL Antibody is: synthetic peptide directed towards the N-terminal region of Human GFRAL. Synthetic peptide located within the following region: TDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	GDNF family receptor alpha like
Database Link	NP_997293 Entrez Gene 389400 Human UniProt ID Q6UXV0
Background	The function of this protein remains unknown.
Synonyms	bA360D14.1; C6orf144; GRAL; UNQ9356
Note	Immunogen sequence homology: Human: 100%; Rabbit: 92%; Bovine: 85%; Pig: 77%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.