DLX1 Rabbit Polyclonal Antibody

CAT#: TA331568

Rabbit Polyclonal Anti-DLX1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 50 ug

Product images

经常一起买 (2)
Transient overexpression lysate of distal-less homeobox 1 (DLX1), transcript variant 1
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-DLX1 Antibody: synthetic peptide directed towards the C terminal of human DLX1. Synthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 27 kDa
Gene Name distal-less homeobox 1
Background DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
Synonyms distal-less homeo box 1; distal-less homeobox 1; OTTHUMP00000082494; OTTHUMP00000082497
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data
Protein Families ES Cell Differentiation/IPS, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...