CLEC4F Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	65 kDa
Gene Name	C-type lectin domain family 4 member F
Database Link	NP_775806 Entrez Gene 165530 Human UniProt ID Q8N1N0
Background	CLEC4F is a receptor with an affinity for galactose and fucose. It could be involved in endocytosis.
Synonyms	CLECSF13; KCLR
Note	Immunogen sequence homology: Human: 100%; Mouse: 86%
Reference Data
Protein Families	Druggable Genome, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.