MTRFR Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-C12orf65 Antibody is: synthetic peptide directed towards the C-terminal region of Human C12orf65. Synthetic peptide located within the following region: HIPSGIVVKCHQTRSVDQNRKLARKILQEKVDVFYNGENSPVHKEKREAA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	chromosome 12 open reading frame 65
Database Link	NP_689482 Entrez Gene 91574 Human UniProt ID Q9H3J6
Background	This nuclear gene encodes a mitochondrial matrix protein that appears to contribute to peptide chain termination in the mitochondrial translation machinery. Two different 1 bp deletions (resulting in the same premature stop codon)result in decreased mitochondrial translation, decreased levels of oxidative phosphorylation complexes and encepthalomyopathy. Alternative splicing results in multiple transcript variants.
Synonyms	COXPD7; SPG55
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 92%; Horse: 86%; Dog: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.