NSUN5 Rabbit Antibody

Specifications

Product Data
Reactivity	Human
Host	Rabbit
Immunogen	The immunogen for Anti-NSUN5 Antibody is: synthetic peptide directed towards the C-terminal region of Human NSUN5. Synthetic peptide located within the following region: ASPETTLSSGFFVAVIERVEVPSSASQAKASAPERTPSPAPKRKKRQQRA
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	50 kDa
Database Link	NP_683759 Entrez Gene 55695 Human
Background	This gene encodes a member of the evolutionarily conserved NOL1/NOP2/Sun domain family. The encoded protein may function as a DNA methyltransferase in the nucleus. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Synonyms	NOL1; NOL1R; NSUN5A; p120; p120(NOL1); WBSCR20; WBSCR20A
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.