PEAMT (PEMT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	phosphatidylethanolamine N-methyltransferase
Database Link	NP_680477 Entrez Gene 25511 RatEntrez Gene 10400 Human UniProt ID Q9UBM1
Background	PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17. This gene encodes an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene is within the Smith-Magenis syndrome region on chromosome 17. Alternate splicing of this gene results in three transcript variants encoding two different isoforms.
Synonyms	PEAMT; PEMPT; PEMT2; PNMT
Note	Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Rabbit: 100%; Bovine: 93%; Dog: 86%; Pig: 86%; Guinea pig: 83%; Zebrafish: 82%
Reference Data
Protein Families	Transmembrane
Protein Pathways	Glycerophospholipid metabolism, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.