Pou3f1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat, Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Pou3f1 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Pou3f1. Synthetic peptide located within the following region: CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	POU class 3 homeobox 1
Database Link	NP_620193 Entrez Gene 5453 HumanEntrez Gene 192110 Rat UniProt ID P20267
Background	Pou3f1 may act as a transcriptional regulator of gene expression during Schwann cell differentiation and myelination.
Synonyms	Oct-6; OCT6; OTF6; SCIP
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.