RHOXF2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RHOXF2 Antibody: synthetic peptide directed towards the middle region of human RHOXF2. Synthetic peptide located within the following region: DQSEKEPGQQYSRPQGAVGGLEPGNAQQPNVHAFTPLQLQELERIFQREQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	Rhox homeobox family member 2
Database Link	NP_115887 Entrez Gene 84528 Human UniProt ID Q9BQY4
Background	RHOXF2 belongs to the paired-like homeobox family, PEPP subfamily. It contains 1 homeobox DNA-binding domain. The function of RHOXF2 remains unknown.
Synonyms	CT107; PEPP-2; PEPP2; THG1
Note	Immunogen sequence homology: Human: 100%; Pig: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.