PRDM14 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-PRDM14 Antibody: synthetic peptide directed towards the middle region of human PRDM14. Synthetic peptide located within the following region: GVTPSLEHPASLHHAISGLLVPPDSSGSDSLPQTLDKDSLQLPEGLCLMQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	64 kDa
Gene Name	PR domain 14
Database Link	NP_078780 Entrez Gene 63978 Human UniProt ID Q9GZV8
Background	PRDM14 is part of a family of PR-domain genes that are involved in tumorigenesis.
Synonyms	PFM11
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.