RAB18 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RAB18 Antibody: synthetic peptide directed towards the C terminal of human RAB18. Synthetic peptide located within the following region: LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	RAB18, member RAS oncogene family
Database Link	NP_067075 Entrez Gene 22931 Human UniProt ID Q9NP72
Background	RAB18 belongs to the small GTPase superfamily.The protein plays a role in apical endocytosis/recycling and may be implicated in transport between the plasma membrane and early endosomes
Synonyms	RAB18LI1; WARBM3
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Goat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.