DENND4C Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DENND4C Antibody is: synthetic peptide directed towards the C-terminal region of Human DENND4C. Synthetic peptide located within the following region: KHNQIITEETGSAVEPSDEIKRASGDVQTMKISSVPNSLSKRNVSLTRSH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	DENN domain containing 4C
Database Link	NP_060395 Entrez Gene 55667 Human UniProt ID Q5VZ89
Background	DENND4C is guanine nucleotide exchange factor (GEF) activating RAB10. It promotes the exchange of GDP to GTP, converting inactive GDP-bound RAB10 into its active GTP-bound form. Thereby, stimulates SLC2A4/GLUT4 glucose transporter-enriched vesicles delivery to the plasma membrane in response to insulin.
Synonyms	bA513M16.3; C9orf55; C9orf55B; RAB10GEF
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Horse: 85%; Bovine: 85%; Rabbit: 83%; Pig: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.