CRNKL1 Rabbit Polyclonal Antibody
CAT#: TA331902
Rabbit Polyclonal Anti-CRNKL1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CRNKL1 Antibody is: synthetic peptide directed towards the C-terminal region of Human CRNKL1. Synthetic peptide located within the following region: SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPED |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 93 kDa |
Gene Name | crooked neck pre-mRNA splicing factor 1 |
Database Link | |
Background | The crooked neck (crn) gene of Drosophila is essential for embryogenesis and is thought to be involved in cell cycle progression and pre-mRNA splicing. This gene is similar in sequence to crn and encodes a protein which can localize to pre-mRNA splicing complexes in the nucleus. The encoded protein, which contains many tetratricopeptide repeats, is required for pre-mRNA splicing. |
Synonyms | CLF; Clf1; CRN; HCRN; MSTP021; SYF3 |
Note | Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Rabbit: 86% |
Reference Data | |
Protein Pathways | Spliceosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |