ENTR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-SDCCAG3 Antibody is: synthetic peptide directed towards the C-terminal region of Human SDCCAG3. Synthetic peptide located within the following region: PAGSPSADFAVHGESLGDRHLRTLQISYDALKDENSKLRRKLNEVQSFSE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	serologically defined colon cancer antigen 3
Database Link	NP_006634 Entrez Gene 10807 Human UniProt ID Q96C92
Background	SDCCAG3 may be involved in modulation of TNF response and may be involved in presentation of TNFRSF1A on the cell surface.
Synonyms	NY-CO-3
Note	Immunogen sequence homology: Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.