RBMY1A1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-RBMY1A1 Antibody is: synthetic peptide directed towards the C-terminal region of Human RBMY1A1. Synthetic peptide located within the following region: REHVCRKDQRNPPSLGRVLPDPREACGSSSYVASIVDGGESRSEKGDSSR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	RNA binding motif protein, Y-linked, family 1, member A1
Database Link	NP_005049 Entrez Gene 5940 Human UniProt ID P0DJD3
Background	RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. The gene that encodes RBMY1A1 is Y-linked. RBMY1A1 may be involved in spermatogenesis. It is required for sperm development, possibly by participating in pre-mRNA splicing in the testis.
Synonyms	RBM; RBM1; RBM2; RBMY; RBMY1C; YRRM1; YRRM2
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.