IQSEC2 Rabbit Antibody

Specifications

Product Data
Reactivity	Mouse, Human, Rat, Dog, Bovine, Pig, Horse, Rabbit, Guinea pig, Zebrafish
Host	Rabbit
Immunogen	The immunogen for Anti-IQSEC2 Antibody is: synthetic peptide directed towards the middle region of Human IQSEC2. Synthetic peptide located within the following region: ARTIQTAFRQYRMNKNFERLRSSASESRMSRRIILSNMRMQFSFEEYEKA
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	163 kDa
Database Link	NP_001104595 Entrez Gene 23096 Human
Background	This gene encodes a guanine nucleotide exchange factor for the ARF family of small GTP-binding proteins. The encoded protein is a component of the postsynaptic density at excitatory synapses, and may play a critical role in cytoskeletal and synaptic organization through the activation of selected ARF substrates including ARF1 and ARF6. Mutations in this gene have been implicated in nonsyndromic X-linked mental retardation.
Synonyms	BRAG1; MRX1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%
Reference Data
Protein Pathways	Endocytosis

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.